GenomeNet

>cmr:Cycma_3733 hypothetical protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MIVKMKINPFVILVFALLCCFTSCSEKHSLPVTENIEFEQVYIPVIQGETATIAYLNFNL
EKEEYLRQLEVKMASGTTIENVSVTLVGEEEQDKFINGVYDSKSHLWRLKEEIVLEKGKQ
QLAIKVTIPEDADLKSKFSLNVPLIEIGEEKCLPDGLVNIKPYRPATALRTANDDEVAAF
RIPGLATSNSGVLLAVYDVRHENSSDLQGDIDVGLSRSHDGGITWEPMQIIMDMGEWGGL
PQNQNGIGDPAILVDNETGTIYVVALWIHGKPGTAAWRSSEPGLSPEKTGQLMLVKSEDD
GRTWSSPRNITQPMKEASWQLFFNGPGKGISMKNGTLVFAAQYKDKEQIPHSTIIFSKDH
GETWQVGSGARPKTTEAQVVELEDGRLMLNMRDDRGGSRAIYTTADMGNSWQEHPTNRSA
LIEPICMASLIKFGEDRLFFSNPATTEGRFNITIKVSNDDGLTWPDNQQILLDGQKGWGY
SCLTKINEEEIGVLYESSQAHMTFQIVPIAEFNAYK

BLAST