GenomeNet

>cms:CMS_0521 alr*; alanine racemase fusion protein (EC:5.1.1.1); K01775 alanine racemase [EC:5.1.1.1] (A)
MTEPASAPASAGPVAPGRRAVIDLDAIRHNVRTLAALAAPARTMVAVKADAYGHGALQVA
RAALESGAESLAVLDVASAVELRRAGIDARLLAWLHGVDTDFRVAVEEEIDLGVSALWEL
KRIAAAGRATGIRARVHLKADTGLSRNGATPELWPDLVRAAVAADSAGELTLHALWSHLA
DASPEDDDAALARFREAVRVAEELGARPVEKHLAASSAGIRLPAARFDMVRFGIAVYGIS
PFDDRSGRDLGLIPAMTLEADVVSVKRVEAGHGVSYGLDHRTAGPSTLVLVPLGYADGIP
RIAAPRASVLLNGRRFPVAGRIAMDQLVLDVGDLPVEVGDTAVILGPGDRGEPTAEEWAG
WAETIGDEIVTRVGPRVDRVHLHERADADDPDGGGAAANGATAEVLSDELVPVATTDDME
ELGRAVARELGAGDLVVLSGPLGAGKTTFTRGLGAGLGVRGPVTSPTFVLARTHPSLVDG
PPLVHVDAYRLADARELDDLDIDFARSVVVVEWGEGKLDGVAEEWWELAIARPTGAGDAD
PDAADGGHDGAHDASDPDAAPEEPRTVRIRRLRARPRA

BLAST