GenomeNet

>cnb:CNBA5410 K03781 catalase [EC:1.11.1.6] | (RefSeq) hypothetical protein (A)
MVTGDAKYRQMAEYTIDQDDKTPYTTYFGVKVSDTDNSLRAGARGPTLLEDFHNREKIQH
FDHERIPERVVHARGAGAFGEFKLHTPLTGITTAKVLTDTSKVVPAYVRFSTVAGSRGSA
DTVRDVRGFATRLYTDEGNWDIVGNNIPVFFINAQTAHDNAWDFMSLHKPALHMQQWITS
DRAIPRSYRMMQGFGVHTFRLINEEGKSTFVKYHWIPHLGTHSLVWDEALKIAGQDPDFH
RRDLWDAIEAGTYAKWDLGVQLIKEEDEHKFDFDLLDATKLIPDELVPVQKIGTLTLNRN
PVDYFSEVEQVAFCTQHIVPGMDFTDDPLLAGRNFSYPDTQVSRLGINWKHIPVNRPVCP
FMTTMREGQMSMFSKNNRTPYHPNRNENLPLTSPKEGGFKSYPAKVSGIKERVQAPKFND
HSSQATLFWNSMSDVEKKHIIDAYKFELSHCTDNLVIQNVINCINEIDHGLATAVHSGFP
HLSLPEAKPNHGKRTEYLSQITGKNQIFTAAGRKIGIFLVPGYVYSQVAPLLAAFKAAGC
MVKFVGPTLGPVEASDGQSFTTEFTFEGCRSTYFDALIFAGGPDNAFLSKLKVGRLIHAA
REAYMHLKAVGAVGNATQWLVDTCLPGEFSPKVKTESSVVQENGVVFAPINPTLHSAQFA
KQFLDGVANHRVWDREVSHIAA

BLAST