GenomeNet

>cnb:CNBA5410 hypothetical protein; K03781 catalase [EC:1.11.1.6] (A)
MVTGDAKYRQMAEYTIDQDDKTPYTTYFGVKVSDTDNSLRAGARGPTLLEDFHNREKIQH
FDHERIPERVVHARGAGAFGEFKLHTPLTGITTAKVLTDTSKVVPAYVRFSTVAGSRGSA
DTVRDVRGFATRLYTDEGNWDIVGNNIPVFFINAQTAHDNAWDFMSLHKPALHMQQWITS
DRAIPRSYRMMQGFGVHTFRLINEEGKSTFVKYHWIPHLGTHSLVWDEALKIAGQDPDFH
RRDLWDAIEAGTYAKWDLGVQLIKEEDEHKFDFDLLDATKLIPDELVPVQKIGTLTLNRN
PVDYFSEVEQVAFCTQHIVPGMDFTDDPLLAGRNFSYPDTQVSRLGINWKHIPVNRPVCP
FMTTMREGQMSMFSKNNRTPYHPNRNENLPLTSPKEGGFKSYPAKVSGIKERVQAPKFND
HSSQATLFWNSMSDVEKKHIIDAYKFELSHCTDNLVIQNVINCINEIDHGLATAVHSGFP
HLSLPEAKPNHGKRTEYLSQITGKNQIFTAAGRKIGIFLVPGYVYSQVAPLLAAFKAAGC
MVKFVGPTLGPVEASDGQSFTTEFTFEGCRSTYFDALIFAGGPDNAFLSKLKVGRLIHAA
REAYMHLKAVGAVGNATQWLVDTCLPGEFSPKVKTESSVVQENGVVFAPINPTLHSAQFA
KQFLDGVANHRVWDREVSHIAA

BLAST