GenomeNet

>cnb:CNBG1620 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MLRNALQSRLSSTLRTAELRAARPVAGPSVLAARTFVSKPLPSPRFRAAVLTPRRLPTRS
YAAEAGGKFTRSKPHFNIGTIGHVDHGKTTLTAAITKHLAEQGGGKFMDYSQIDKAPEEK
ARGITISTAHVEYETPNRHYAHIDCPGHADYIKNMITGAAQLDGAIIVVSATDGQMPQTR
EHLLLARQVGIKKLVVFINKVDQVDDPEMLELVEMEMRELLGQYGFDGEETPIVMGSALA
ALEGRDPERGAQKIQELMEKADEWLDVPSRDLDKPFLMYVEDVFSISGRGTVVTGKVERG
TITKGSEVEIVGLGAPVKTILTGIEMFHKELERGEAGDNMGALLRGIKREQVRRGQVLVQ
PGSIKSVKKFKAQIYILTKEEGGRYTPFMANYRPQLFIRTTDVTCALTFPEGTEGAHEKL
VMPGDNVEMIGDLVHDIALEPGSRFTLREGGKTIGTGIVSEIYE

BLAST