GenomeNet

>cnb:CNBG1620 hypothetical protein; K02358 elongation factor Tu (A)
MLRNALQSRLSSTLRTAELRAARPVAGPSVLAARTFVSKPLPSPRFRAAVLTPRRLPTRS
YAAEAGGKFTRSKPHFNIGTIGHVDHGKTTLTAAITKHLAEQGGGKFMDYSQIDKAPEEK
ARGITISTAHVEYETPNRHYAHIDCPGHADYIKNMITGAAQLDGAIIVVSATDGQMPQTR
EHLLLARQVGIKKLVVFINKVDQVDDPEMLELVEMEMRELLGQYGFDGEETPIVMGSALA
ALEGRDPERGAQKIQELMEKADEWLDVPSRDLDKPFLMYVEDVFSISGRGTVVTGKVERG
TITKGSEVEIVGLGAPVKTILTGIEMFHKELERGEAGDNMGALLRGIKREQVRRGQVLVQ
PGSIKSVKKFKAQIYILTKEEGGRYTPFMANYRPQLFIRTTDVTCALTFPEGTEGAHEKL
VMPGDNVEMIGDLVHDIALEPGSRFTLREGGKTIGTGIVSEIYE

BLAST