GenomeNet

>cnc:CNE_2c13520 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; ribulose bisphosphate carboxylase small subunit (A)
MRITQGTFSFLPDLTDAQITSQLEYCLNQGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
MRYSIESYAVQARPEGSRY

BLAST