GenomeNet

>cne:CND02450 dihydrolipoyllysine-residue acetyltransferase; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MLSFAQVAKRSAAVSFRRQAVASRTLRTSAPSNVLSKFAMPAMSPTMTEGGVAQWKKKEG
ESFSAGDVLIEIETDKATIDVEAQDDGIMAKIIAQDGTKNIAVGTPIAIIGEEGDDLSQA
DALAAESQSESAPSQKEAAPKEEKTAPKEEKSESSTTPAVGVPGEQKSGAGDAQTSPAKA
PEHPSKGDRPKFFASPLARKIALENGIPLAEIKGTGPNGRIVEADVKNYKPSAAAASTPA
AGKSAAVPADYEDIPTSNMRRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKAGE
SKTKLSVNDFIVKAASLALADVPEANSAWLGETIRTYKKADICVAVATPNGLITPIIKDV
GAKGLATISAETKALASRARDGKLKPEEYQGGSFTISNLGMFGVDEFTAIINPPQSCILA
VGKTTTKLELAPEDPKGFKAVQVMKVTLSADHRTVDGAVGARWLKAFREYMEQPLTFML

BLAST