GenomeNet

>cno:NT01CX_0551 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSKLYFRYGAMNSGKSTNLMQVAHNYEERGMKVIIIKPKTDSKGGENVVSRLGVTRRVDM
LLESNENAYEKVKDICNKEGKVNCVLVDEVQFFKKDQIDQLLEIAVKLDIPTICYGLRTD
FQMNGFEGSTRLLLLAHSIEELKTICRCGRKALLNGRKINGKFVFEGKQVAIDKEDNVEY
ESLCPKCYFEFRDKYNNK

BLAST