GenomeNet

>cpas:Clopa_3523 hypothetical protein; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIKISGDNFNINTIIDQYKNNSIERYVLEKLSSSNEVYNYGSVDELKFELTLRRNIVNAA
IDLGKSNFDFAVFRKSKCNPDYWERTPQGGFLLKNGVNASSAINDIYKNSHKYATECATA
MVIVYYKAVLDSFGGRLLDATFPNIYLMNWHYMDRNLGLDISDDIADFLPGDCRYFKNPQ
VNPLTPEWQGENVIVLGNGKYYGHGIGIKTADEIIKALNEERFMGSRQSAYLLNSATRPD
FKHLAYIYLKSSSRSLGSERRREHRHH

BLAST