GenomeNet

>cpe:CPE1094 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) conserved hypothetical protein (A)
MKIPCSMMTQHPDNVETYISIQQEPAEAIKGLTPQDKGGLGIEEVMIDFEGKLTPYHQTS
QIALGLISNGIIPGKDVRVTPRIPNANKESVFRQLMSIMSIIETNVQSKELTGTPAISEV
VVPMIETGKEISEFQDRVNSVVDMGNKNYKTKLDLNSVRIIPLVEDVPALANIDRILDEH
YEIEKSKGHILKDLRIMIARSDTAMSYGLISGVLSVLMAVDGAYKWGEKHGVTISPILGC
GSLPFRGHFSEENIDEILATYSGIKTFTFQSALRYDHGEEATKHAVRELKEKIAQSKPRN
FSEEDKDLMKEFIGICSKHYLQTFLKVIDTVSFVSDFIPKNRDRLTKAKTGLEYNREVAN
LDNVADLVKDEVLKQEILSIDNSKEYAVPRAISFTGAMYTLGMPPELMGMGRALNEIKTK
YGQEGIDKLLEIYPILRKDLAFAARFANGGVSKKIIDEEARQEYKEDMKYVNEILNLGLD
YDFLNENEFYHTLLKTTKPIIMHLMGLEENVMRNSTEELKILNEWIVRMGKVRGSIG

BLAST