GenomeNet

>cph:Cpha266_1908 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) Type II site-specific deoxyribonuclease (A)
MTLDLVNYEQKAHEAVKSFWSNREVAKQKQLLTGKADHGERAGVTAGKNMDGFLALVLDI
IQANGLAHAEIHQNRSMLTLPGYFRPTKLWDLLVIYKGELIAAIELKSQVGSFGNNFNNR
TEEAIGTAYDLWTAYREEAFGKQPRPFVGWLMMVEDAPKSRCAVRDASPHFPVFGEFEGA
SYLMRYDLLCQKLVKEQLYTTAALITSTRCAAETGEFSEMSSMTGFRPFVTALAGHVAAA
AARLD

BLAST