GenomeNet

>cpi:Cpin_4521 ROK family protein; K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MASSDHILAIDVGGSHIKGTILNSKGEWQMDYKRLPTPKGAKPKDVLETISALVKDMPAY
DKISVGFPGYVRNGIVYTAPNLGNPNWKDIDLGQQIADLLKKPVRLVNDADQLGLGVVSG
KGYELAVTLGTGFGTALLIDGYLLPHLELAHHPVTKEHDYDEYIGNKALEEEGKEKWNKR
MEKVLQILKTVFNYDRLYIGGGSADELTFPLDDNIHIFTNKDGIKGGARLWDMEDKYHIT
TNYPK

BLAST