GenomeNet

>cpm:G5S_0127 murC; MurC/ddl bifunctional enzyme (EC:6.3.2.8); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] K01924 UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8] (A)
MRTTPHYHFIGIGGIGMSALAHILLDKGFSVSGSDSSQNSIINKLKTKGALCFYGHHEDH
IPEHATVIYSSGISEDNVEFCKAKQRGLPLLHRSQCLAMLMEESTKILISGSHGKTTTTS
LIIAIFQEAKNDPSYAVGGLNSESLNGHAGSSSIFIAEADESDGSLKHYAPDVAVVTNLD
EEHLVNYDDDPEKLLKAMQEFSNKVRDSQKVFYNGDCPQLKGEISGITYGFSPSCQLQVV
SFYQREWQSSFSFIFCGIEYQNIELNLPGRHNVLNAAAACGVALTFGIEISVIRKALKKF
PGVQRRLEQKNCSNKYLYLEDYAHHPVEISHTLQAVRDAVGLRRVIAIFQPHRFSRLQAC
LDLFPHAFKDADEVILTDVYSAGEPFVEISMEQLSNQIALKSLVKCSYIPFDQLVQFLKE
KIRVHDVCISLGAGNIHVLGSALKNFEPRKLSIGLVCGGKSCEHEISLLSARHVSHRFSQ
EYYDCTFFVISRDGLWNVVQDLNTPLPKEQGSPVLSSEIAKALLSIDFFLPILHGPFGED
GSIQGFFEILGKPYGGPDLLPAAISMDKLMTKRVASAVGVPVVPYQELSLFAWKRNPEGC
IRSILDIFTFPMVVKSSHLGSSLGIFLVNNKEELEEKISEAFLYDTDIFIEESRLESREI
EISCIGQPYSFYIAKPNERRGSQGFIGYHEKYGLNGISSARIIFDLQLPKESENRVKEFA
ERVFKAIQGKGCARIDFFLDEEGNYWLSEINPIPGMTASSSFLRAFEQSEWSAEKVLDYL
IIEGLHRFDKQEKVLRVPHPTCDYAKKS

BLAST