GenomeNet

>cpo:COPRO5265_0834 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MEIITQDGWLEVITGCMFSGKTEELVRRLRRAVIAKKETIAIKPALDTRYDLVAVVSHSG
FSFNAIPVEDPKSILGMAKDAEVVGIDEAQFFTGELVPVIRELLQNKKRVIVAGLDLDFR
GEPFGIMPTLLALADEVTKLHAICSVCGNIATKTQRLINGRPARYDDPTILVGGLETYEA
RCNLHHEVPGKTLTLFKE

BLAST