GenomeNet

>cpo:COPRO5265_1446 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) restriction endonuclease (A)
MKYSNLFYKLISCKDEDDVFEYLIRNLKETIISWDFFVAWEKVINKVEDIEISLNLLNYL
VGKENITEKFAELVSKYPEVIDVLPVLVAWRAKNVKVLDPLDDNIFNYKEYSFEKKSSYT
TEEIASLTEFADKTGLLAMFKNENIKSVVDYVTGVEVGLDTNARKNRSGAAMEMITELLI
KRICAKNRYNYISQATAHKINELFGYEVKVDKSERSFDFAIDNGDKLYLVETNYYGGGGS
KLKAVAGEFVTLCRFLKRETPQHTFIWITDGLGWKTAKKPLREAFDEVDYILNLSMLENG
VLENIILEGL

BLAST