GenomeNet

>cpr:CPR_1446 phosphofructokinase family protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MNCIIAQSGGPTSVINASVYGLVKANKKLNLYENVYGGLNGIEGILNKKIINLSDLDELQ
LERFKNSPASGLGSCRYKLKPLSESEDEYLKLLDILNSLNIKAFFYVGGNDSMDTTAKLN
AFAKAKNIDIKFFGIPKTIDNDLMHTDHTPGFGSAAKFISTAVLETYLDSKVYTNNGIFI
IETMGRDTGWLAASGALATINGNKCADLVYLPERAFSVQSFLTDVARIFKEKKHVYIVAS
EGLKDENGKFLTETAPNDDSFGHAQLGGVGAYLKNLIIQASITHRVKSLELNTLQRCSMH
ASSKIDVNEAVMVGQAALEASVNSEGGYMVAIRRDSSFPYKSSTFLIEADKIANNIKYFP
NEWINEEGNNITEEGLSYLKPLISDFEDRDSLPLYHSFVL

BLAST