GenomeNet

>cpr:CPR_1446 K21071 ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90] | (GenBank) phosphofructokinase family protein (A)
MNCIIAQSGGPTSVINASVYGLVKANKKLNLYENVYGGLNGIEGILNKKIINLSDLDELQ
LERFKNSPASGLGSCRYKLKPLSESEDEYLKLLDILNSLNIKAFFYVGGNDSMDTTAKLN
AFAKAKNIDIKFFGIPKTIDNDLMHTDHTPGFGSAAKFISTAVLETYLDSKVYTNNGIFI
IETMGRDTGWLAASGALATINGNKCADLVYLPERAFSVQSFLTDVARIFKEKKHVYIVAS
EGLKDENGKFLTETAPNDDSFGHAQLGGVGAYLKNLIIQASITHRVKSLELNTLQRCSMH
ASSKIDVNEAVMVGQAALEASVNSEGGYMVAIRRDSSFPYKSSTFLIEADKIANNIKYFP
NEWINEEGNNITEEGLSYLKPLISDFEDRDSLPLYHSFVL

BLAST