GenomeNet

>cps:CPS_1585 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) zinc metallopeptidase family protein (A)
MKNITKTFKFTGLALVIAASLTACNQEPSQQASVEKAAKISAQAALTATDAQQFLDNVAK
EMVTLNLEGSRAAWIYANFITEDTASLAAEADQKSTDAGVRYAMQAATFDDVDVNPTQRR
QLNVLKQSLVMPAPQDPEKSAELATIGAKLGSIYGKGSYTTKAGEKLSLGDMTSKMANSR
DYDELLEMWTGWREISPEMKPLYTRQAELANEGAKGLGYQDLGAMWRSNYDMPADDFAKE
LDRLWGQVKPLYDDLHCYVRTELGETYGTDKVAQDKPIPAHLLGNMWAQSWGNIYDLVAP
EDADPGYDVTKQLAEHNYDEIKMVRGAEKFFTSLGFDALPETFYTRSLFTKPADRDVTCH
ASAWDLDAKDDIRIKMCIQKTGEEFNVIHHELGHNFYQRAYKDQPVYFQNSANDGFHEAI
GDTIALSVTPKYLKEIGLIDTIPDESKDIGLLMKQALDKIAFIPFGLMVDQWRWKVYSGE
IKPEDYNTSWWELREKYQGVAAPIDRDVDSFDPGAKYHVPAGVPYSRYFLAHIQQFEFHR
ALCEISGNTDPIHRCSIYNSKEAGTALNTMLEMGSSQPWQQAYKVITGNEQMDATAILDY
FAPLHVWLKNKNQGKQCGF

BLAST