GenomeNet

>cps:CPS_3627 K01792 glucose-6-phosphate 1-epimerase [EC:5.1.3.15] | (RefSeq) epimerase family protein (A)
MTKIPLNNDFAQVTSITLNQESGEERFEGLNISHAYCQAKVSLYGGQVLSFKPSGHRDVL
WLSEQASYQMGKAIRGGIPLCWPWFGANDKQSQYLTENPNTALKPVNHGFARQLPWHITS
INADESGVTLVLVLSGDKQHPLWPNAYTLTQTLFFGKNLKQTLTMSNDSLEDAQYSAALH
SYFTVSNPGNVSIDALTGVRYSDKLTGNSSTQQEAVSCVGEIDREYHSSEKMTVIDNHWQ
RKIDIISSNCQQWVLWNPGTELANTMADIHPQGEQEYVCLEAANTSWQIIPAGETVVISQ
EITVTNC

BLAST