GenomeNet

>cpv:cgd5_4440 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase of likely bacterial origin (A)
DWKYFNKMAKLYFYYSAMNAGKSTVLLQSSFNYQERGMKTILFTISKDCRFEEGSICSRI
GLSEKAHTFTPDLKLLDIINQENNKEKIDCVLVDESQFLTKFQVRELCIVVDKLNIPVLC
YGLRTDFKGNLFEGSKYLLAWADKLTEIKTICRCGKKATMTIRLNSNGEPVFSGEQILIG
DNSIYTSVCRKHHIINCEEYNF

BLAST