GenomeNet

>cpw:CPC735_005140 Beta-eliminating lyase family protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MERADEVRNLLDPVQERILQFIQSADRGSKAIIAHDPSDETDPFFSGLLNLKRPSELQQE
LQVDFPDSGQGADGLLQILDRILQYSVNTWHQGFLDKLYASTNAPGLAAELIIAALNTNV
HVYQVAPALTVIEKSTAARLASLFGLNGLYAGGIAVQGGTASNTTAIVIARNTLFPETKT
EGVSGNQFVLFSSAHGHYSIEKAAQMLGFGSKAVWVVPVDEKGQMIPKALDDLIITAKSQ
GKKPFFVNATAGTTVVGSFDPLPEISEICRKHNLWFHVDGSWGGSFIFSSKQKSKLTGSH
LADSITFNPHKMLGVPVTCSFLLAADIRKFHRANTLPAGYLFHNEEYTKGFWDLGDLTLQ
CGRRADALKLFLSWMYYGSEGYEQKIDSACSVAEHLSTVVGNNPHLILLTENPPPCLQVC
FYYAPLGRMAYPPGREINGKALSEEERAELNSQITEEIVQKLVPQGFMVDYAPPSDGDTF
AKDGKFFRCVVNVLTKEETVDSLVNTIVKLGSTIVKRRLGSELNIPTPTAYPAPTSGFRP
KNPAEKGHGPVVFE

BLAST