GenomeNet

>cpw:CPC735_025180 Mitogen-activated protein kinase, putative; K04441 p38 MAP kinase [EC:2.7.11.24] (A)
MAEFVRAQIFGTTFEITTRYTDLQPVGMGAFGLVCSARDQLTNQAVAVKKIMKPFSTPVL
AKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARVQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDVWSAGCIFAEMLSGRPLFPGKDHVNQFSIITELLGSPPDDVIKT
ICSANTLQFVQSLPKRERQPLSEKFKGAEPLAVDLLERMLVFDPKKRITAAEGLAHEYLA
PYHDPTDEPVAETQFDWSFNDAELPIDSWKVMMYSEILDYHNVDQDSQGIHGTPLNTEAQ
RVPM

BLAST