GenomeNet

>cpw:CPC735_025180 K04441 p38 MAP kinase [EC:2.7.11.24] | (RefSeq) Mitogen-activated protein kinase, putative (A)
MAEFVRAQIFGTTFEITTRYTDLQPVGMGAFGLVCSARDQLTNQAVAVKKIMKPFSTPVL
AKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARVQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDVWSAGCIFAEMLSGRPLFPGKDHVNQFSIITELLGSPPDDVIKT
ICSANTLQFVQSLPKRERQPLSEKFKGAEPLAVDLLERMLVFDPKKRITAAEGLAHEYLA
PYHDPTDEPVAETQFDWSFNDAELPIDSWKVMMYSEILDYHNVDQDSQGIHGTPLNTEAQ
RVPM

BLAST