GenomeNet

>cpw:CPC735_027520 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) SET domain containing protein (A)
MAGHDDEEARIETVKDAVTDMKLERQSSTESIAPNGILDTITPKDEPNGHLSSKPSTPSL
KPPKSRSRSSNSLAKDEVPEEKVGGDITIKQEPGQPPKLARSASQKLPARAAPLFTDLPD
KTTEATSTFQLMEVCTYANKYLGYTEHAMDCDCAEEWDAATCRNTACGEDSDCINRATKM
ECFGDCGCGDSCQNQRFQRREYAKVSVIKTEKKGYGLRADCDLRPNEFIFEYIGEVINEP
QFRRRMIQYDEEGIKHFYFMSLNKGEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLR
MGIFAERYIKAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTERATKLSHATIE
ALGIDDPDGWDTAVARRPRKKKTGEDDEEYVDSLQPKSLDENGVTKVMAALMQCKEKWIA
VKLLGRIQRCEDERVRHRVVRMHGYQILNSQLNTWKDDFNVVLQILDILDKFPRLTRNKI
IDSKIEGTVSPLQECDDERVAEKAKALLEIWSALEVGYRIPRMKRDPAAVNNTPTANHYE
RRETAKDDRKPNSSKSRSSSRSRSRSVDVTRNAPRGPAALTRGGGKGHMHSYRPGQRPFR
RPFNPLPKGWFAAESNGRTYYYSATGETTWSRPTAPAVQPPPPPKRESKEKTLQDIIDGI
MNAKENTPKAKDKSATPATPADAKIPEKKEHKEKWRSYSEEKQKKLYENTLFPHVKYIVD
KFKHKLPKDDLKRYAKEVAKKLVNSDFKNNRVEDPTKISEKQIKQVKKYCKEYFDKAVAK
HRAYEEKKAERKSKGSVKATTSATIDKAETTSTKAPPQFDGAAETGDGDSDVQLSDAEYE
DGQEGSSHHSGLKRKRTDDEDFENDHENGGVSPTKRQRSASLPIIPPPPPPMSPSNLVLD
DGSREALKRQRTEGAEDDEYGDSTISSGKRQRSETPPPPPPPPPPADIPPENIESENEND
KDQEELQDYDVQEAKWGKEDNIAIQSPSHSPFPAQSISNHSNTAHETDSHS

BLAST