GenomeNet

>cpw:CPC735_027520 SET domain containing protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MAGHDDEEARIETVKDAVTDMKLERQSSTESIAPNGILDTITPKDEPNGHLSSKPSTPSL
KPPKSRSRSSNSLAKDEVPEEKVGGDITIKQEPGQPPKLARSASQKLPARAAPLFTDLPD
KTTEATSTFQLMEVCTYANKYLGYTEHAMDCDCAEEWDAATCRNTACGEDSDCINRATKM
ECFGDCGCGDSCQNQRFQRREYAKVSVIKTEKKGYGLRADCDLRPNEFIFEYIGEVINEP
QFRRRMIQYDEEGIKHFYFMSLNKGEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLR
MGIFAERYIKAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTERATKLSHATIE
ALGIDDPDGWDTAVARRPRKKKTGEDDEEYVDSLQPKSLDENGVTKVMAALMQCKEKWIA
VKLLGRIQRCEDERVRHRVVRMHGYQILNSQLNTWKDDFNVVLQILDILDKFPRLTRNKI
IDSKIEGTVSPLQECDDERVAEKAKALLEIWSALEVGYRIPRMKRDPAAVNNTPTANHYE
RRETAKDDRKPNSSKSRSSSRSRSRSVDVTRNAPRGPAALTRGGGKGHMHSYRPGQRPFR
RPFNPLPKGWFAAESNGRTYYYSATGETTWSRPTAPAVQPPPPPKRESKEKTLQDIIDGI
MNAKENTPKAKDKSATPATPADAKIPEKKEHKEKWRSYSEEKQKKLYENTLFPHVKYIVD
KFKHKLPKDDLKRYAKEVAKKLVNSDFKNNRVEDPTKISEKQIKQVKKYCKEYFDKAVAK
HRAYEEKKAERKSKGSVKATTSATIDKAETTSTKAPPQFDGAAETGDGDSDVQLSDAEYE
DGQEGSSHHSGLKRKRTDDEDFENDHENGGVSPTKRQRSASLPIIPPPPPPMSPSNLVLD
DGSREALKRQRTEGAEDDEYGDSTISSGKRQRSETPPPPPPPPPPADIPPENIESENEND
KDQEELQDYDVQEAKWGKEDNIAIQSPSHSPFPAQSISNHSNTAHETDSHS

BLAST