GenomeNet

>cpw:CPC735_030760 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase flavoprotein subunit, putative (A)
MNGCSSHGLGRRIPQHKTNPHHIVYSAKGNRRSFISSAPVCAVEQVSQGFSDGTRHFNII
DHRYDAIVIGAGGAGLMAAVGLAESGLETACITKLFPTRSHTVAAQGGINAALGNMTEDD
WRWHMYDTVKGSDWLGDQDAIHYMCREAPRTILELEAYGMPFSRTAEGKIYQRPIGGQSL
KYGTSGQAYRTACAADRTGHAMLHTLYGQSLKHNCNFFIEFFVLDLMMIDGTCVGAVALD
METGTLHRLFSRNTILATGGYGRAYFSCTSAHTSTGDGCAMASRAGLPLQDMEFVQFHPS
GIYGAGVLITEGARGEGGYLLNSKGERFMERYAPTAKDLASRDVVARSMNMEIREGRGVG
AEKDHIYLQLSHLPRDLILERLPGIAETASIFAGIDITKEPIPVLPTVHYCMGGIPTNYR
GQALDINPITGKEKPVPGLYAVGETACVSVHGANRLGANSLLDLAVFGRASAQHISENNE
KGMPHAPVPKDIGMSSFEDMERIRKSDGSRLTAGLRLDMQRAMQSDVAVFRTEDSLKSGV
SRVQRVDQAFKNDVCVKDKSLIWNSDLIETLEMRNLLTCAAQTAKGAQERKESRGSHARE
DFTERDDERFLKHSLTWQNGTAEDVRVGYRDVIFATLDEDECPSVPPKTRTY

BLAST