GenomeNet

>cpw:CPC735_039850 succinate dehydrogenase flavoprotein subunit, putative (EC:1.3.5.1); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSFNGLRSLAPATRFSRSLRDQRRLFSSSRPAARIITSQPLRAKEASPFLTKKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLMENGECKGILAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEV
LTIDEKGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNATPNTP
HKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDANWMKHTLTFQKEPHGKVDLTYRAVTQTTLDESECKPVPPFKRVY

BLAST