GenomeNet

>cpw:CPC735_050230 Glutathione S-transferase, N-terminal domain containing protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MAGKLKIYGNMASPYSDIVLLTVAEGGLKDYDYVNVDFRKGAHKWKTATKVPLAQHPSFL
LMNPMGKFPVLTTPEGDHLYESRPMAKYIATRYNVTDLLPDTKDALALARFEQAVCLEMC
YFNARA

BLAST