GenomeNet

>cpw:CPC735_054670 K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] | (RefSeq) SET domain containing protein (A)
MAPTPPPKQKGKLTLAQLAAYDDIVTDALVDRAFFWTKIRKNRPKYFAVRGVVEDDVTSI
LLHDVIVAKDVIKAEESLLNLSGLRKYVEKLKSDKEKEWFRRHLRKYIAIYLPDCPFEVT
TTNRYTITTHEAALSARKFIRTGDTIKHLSGTLVAITPEEEKTLDLTRRDFSIVMSSRKK
TPSLFLGPARFSNHDCNPNARLVTKGSEGMEIVAIRDISIGEEITVSYGENYFGVDNCEC
LCHTCELSLSNGWSPGGPPEHDSRASTPESTTEHQEKSSSGSEKRKSPPESPSHPSEDMP
SKRPRFENILNLRLELSPPSSPDPIAEPLITVNGGLRALRSHFASLAGKSELRHFQKPHS
NFISASSSSDQTSCSLCPDDEAPTSTRSTSATSVSDSNVPVKTEPTVEQQPRASSETASK
TISGDHGLHVQDVIRDNDESDLSDLSASWEINDREMTAVKREPVKKKKRKRKSSIIPTIE
HEAPKARTPGDYTKTPKLLAQRYDRWVDCQTCNAWFVQGDAYLTRKECPRCERHSKLYGY
CWPKTDREGRNDTEERVMDHRTIHRFLRTEDEARVQRRGRGVSHATSPTPDVSENKTETD
ASEFGDERRLTRSLRRARSSLHLAI

BLAST