GenomeNet

>cpw:CPC735_057720 K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] | (RefSeq) SET domain containing protein (A)
MARDPMLSPSSTPTSSALDSDATAIDATVPVLTPATSISEQSTPVDTEKDGEHRAKKAKP
SRRVTRSSLKNGELEANGGGEAMLTRPNDGSLDNTNTQEDEDCTSLLNGAEDASGSVDKQ
SGKNAKAAGKKPNKKAGNKSPKRRSTRLSLLAKTKDLAQSAPSVLGKRTLDAISKSKDKV
KTIDRKASLRPRVENERKEASTPAPQEPSPKKRRVSGDNKSTCQVPRQEQTATRENSLIR
QKRKPWLKHGLYAGQEYIDSSVPKSKRGTRDAKNNGQQSQVFPFPMYAGARLLENGRAYK
LPFDIFSPLPHGQPKPNEWRKANKNVFVGDAASIWKAAKIKEHSTCTCTPETGCDENCQN
RYMFYECDDTNCKLGSELCRNRPFSALRRRAKAGGKFNIGVEVIKTEDRGYGVRSNRSFD
PNQIIVEYTGEILTQEECERRMRTVYKKNECYYLMYFDQNMVIDATRGSIARFINHSCEP
NCRMEKWTVAGKPRMALFAGEDGIMTGEELTYDYNFDPYSQKNVQECRCGAPTCRGVLGP
RPKESWKNKDKEKKSAPAAKRKVDSALDESASRLNKKPKPSRASSLKTGVKKAVSKARTA
LKSTQAKGKVKRVGRPAKKAASIKPIPVKKRRSTLTRAKMPVKSASKSAEGDEKPPRNKG
RKLKMPSKPRLGNSIAAARASNKTPALMRKFLEAGDTKGGAKVVSDTIKPGRKIRAARTA
DVRSSPDNVPVSRKRGRAKKTL

BLAST