GenomeNet

>cpw:CPC735_057720 SET domain containing protein; K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] (A)
MARDPMLSPSSTPTSSALDSDATAIDATVPVLTPATSISEQSTPVDTEKDGEHRAKKAKP
SRRVTRSSLKNGELEANGGGEAMLTRPNDGSLDNTNTQEDEDCTSLLNGAEDASGSVDKQ
SGKNAKAAGKKPNKKAGNKSPKRRSTRLSLLAKTKDLAQSAPSVLGKRTLDAISKSKDKV
KTIDRKASLRPRVENERKEASTPAPQEPSPKKRRVSGDNKSTCQVPRQEQTATRENSLIR
QKRKPWLKHGLYAGQEYIDSSVPKSKRGTRDAKNNGQQSQVFPFPMYAGARLLENGRAYK
LPFDIFSPLPHGQPKPNEWRKANKNVFVGDAASIWKAAKIKEHSTCTCTPETGCDENCQN
RYMFYECDDTNCKLGSELCRNRPFSALRRRAKAGGKFNIGVEVIKTEDRGYGVRSNRSFD
PNQIIVEYTGEILTQEECERRMRTVYKKNECYYLMYFDQNMVIDATRGSIARFINHSCEP
NCRMEKWTVAGKPRMALFAGEDGIMTGEELTYDYNFDPYSQKNVQECRCGAPTCRGVLGP
RPKESWKNKDKEKKSAPAAKRKVDSALDESASRLNKKPKPSRASSLKTGVKKAVSKARTA
LKSTQAKGKVKRVGRPAKKAASIKPIPVKKRRSTLTRAKMPVKSASKSAEGDEKPPRNKG
RKLKMPSKPRLGNSIAAARASNKTPALMRKFLEAGDTKGGAKVVSDTIKPGRKIRAARTA
DVRSSPDNVPVSRKRGRAKKTL

BLAST