GenomeNet

>cpy:Cphy_2858 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MSKLYFKYGCMNSSKSANLLMIRHNYEEQGFNILLLKPSIDDREGKSIIKSRIGIEAECI
MVKPLDSIKDIFQKNPADIIMVDEAQFLTKDQVDELYDISFQNNVLCFGLLTDFQQRLFE
GSQRLIELAESLQEIKTVCACGRRATMNVRFDEHGNVITRGEQVDIGGNDKYRAMCKYCY
NNLTKK

BLAST