GenomeNet

>cpz:CpPAT10_1893 K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] | (GenBank) adhA; Alcohol dehydrogenase GroES-like protein (A)
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGTVDGRMAIRY

BLAST