GenomeNet

>cqu:CpipJ_CPIJ009107 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) hypothetical protein (A)
MVTKVLVLALLASVALAVNPDLEDQELAGQKYVSDLEADILARNNEATEASWAYESDISE
AHLKARDEIQVRNANYFKEVARELRKYDWQNFKNGDLKRMFKKMTDLGYAALPEAKFTEL
LDAISSMSENYATAKVCDYKNREKCDLALEPELTEIFATSRDPEELKYYWTQWYDKAGTP
TREAFDKYIKLSNEAAKLNNLSSGAEAWLDAYEDETFEQQADAAIEQIRPLYEQIHAYVR
HKLRERYGEDVVSEKGPIPMHLLGNMWAQSWDNVADFTTPYPNSQLMDVTEEMVKQGYSA
KQMFEMGDDFFVSLNMTRLPQSFWEKSILEKPTDGRELVCHASAWDFYKTDDVRIKQCTR
INMEDFFTAHHELGHIQYFLQYQHQPSTYREGANPGFHEAVGDVISLSVSTPKHLEKIGL
LKDFVMDEEAKMNQFYRQGLSKLVFLPFAYTLDKYRYGMFRGEIKPDQANCKFWEMRTKF
SGIEPPVVRSEKDFDGPAKYHMSADVEYLRYLVSFIIQFQFHRSACELAGEYVKGDPVKT
LNNCDIYQNANAGNAIKEMLALGSSKPWPDAMEVLTGQRTMSADALLEYFQPLQDWLVVE
NKRLGAYVGWEKSDKTLLLDR

BLAST