GenomeNet

>cqu:CpipJ_CPIJ017679 succinate dehydrogenase; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MCSPVQFWPPASETNGSLAAGETSNADDVSYFYTDVYGGKLRSAQVALAAQMLVYPCLMM
EPAYSLVQDRMTIYGTCDYEKMFRLELTRSEGRWNATAQLSTKNCRKELVEDFVLEWHGR
NYTVFANSWNVEKSSLTVHLLVHKRGMSHAQVREIYPVLDIAFGKVRDENCRNETGEKKG
DAQYLQSVDDRAKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDES
TAARLDKLKDPFSVYRCHTIMNCTRTCPKGLNPGKAIAEIKKLLSGIAKKDAPGLETAAL
HSK

BLAST