GenomeNet

>cre:CHLREDRAFT_102571 hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
GTQHEPQHGGVGQLHLIVGPMFAGKTTRLIQRVREAEAAGRRTVVVKSAVDTRYAVDAVV
THDGVRAPCVPLSRLGDLRAALGEAEYAATQVVAIDEAQFIGDLREAVLQATEADGKTVY
VAGLSGDFRRDNFGQISQLLPLADNVEKLSGRCTFCEQQGRRSASHFTLRIAASTQQELV
GGAEAYAPVCREHYV

BLAST