GenomeNet

>cre:CHLREDRAFT_102571 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) predicted protein (A)
GTQHEPQHGGVGQLHLIVGPMFAGKTTRLIQRVREAEAAGRRTVVVKSAVDTRYAVDAVV
THDGVRAPCVPLSRLGDLRAALGEAEYAATQVVAIDEAQFIGDLREAVLQATEADGKTVY
VAGLSGDFRRDNFGQISQLLPLADNVEKLSGRCTFCEQQGRRSASHFTLRIAASTQQELV
GGAEAYAPVCREHYV

BLAST