GenomeNet

>cre:CHLREDRAFT_108283 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) predicted protein (A)
MVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIVANGWIPCLEFAESDKAYVSNESAIRFG
SVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGF
LVQRPKSARDWQPANKRSV

BLAST