GenomeNet

>cre:CHLREDRAFT_195972 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) SDH1; succinate dehydrogenase subunit A (A)
MPVLAKLLGGASKASSLQQLAGLGQRAALAATQQAGFASQSYPVIDHQYDAIVVGAGGAG
LRAAVGLSELGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWL
GDQDAIHYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHAMLHTLYGQAMKHDIQFYVEYFALDLIMDSDGVCRGVMALCMEDGTLHRFQAHQT
VLATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGCGPEKDHIYLHLNHLP
PELLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGVPTNYMGEVLAPTPDNPDKV
VPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRIGQIMKPNTPHKPLPATAGEG
AVARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQESLEEGCKLIDETMASFQDVKT
TDRGLVWNTDLIETLELENLLINAAVTMHSAEKRKESRGAHAREDFTQRDDANWMKHTLG
FLPSTNDKVNISYRPVHMKPLSEEMPFIPPKPRVY

BLAST