GenomeNet

>cre:CHLREDRAFT_82986 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) RBCS1; ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 1, chloroplast precursor (A)
MAAVIAKSSVSAAVARPARSSVRPMAALKPAVKAAPVAAPAQANQMMVWTPVNNKMFETF
SYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESAIRFGSVSCLYYDNRYWTM
WKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRPKTARDFQPA
NKRSV

BLAST