GenomeNet

>csd:Clst_0338 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) hypothetical protein (A)
MILIGRNIVTEDRLTAMFGQDETKYQIADMMLKAGTVFTYKDEQLFDFEVKTRKEIVRAS
ERLNNSFFSFRLFKDSVCNKRYWDRTEEGGFRLKKNVSAYDAVRDILRNSRLYGTECATA
IVIVFYLALTEVLPRELFDRLFPDIYLMDWKYLDKDLGVRNYRGVKDAIPGDCLYFKNPD
VNPDTPEWQGENVIKLLNGYYYGHGIGIKTADGIIRDLNRNRITGSERSAYLADLIVKPD
FKYLGEQLLFWHLRPQE

BLAST