GenomeNet

>csd:Clst_0338 hypothetical protein; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MILIGRNIVTEDRLTAMFGQDETKYQIADMMLKAGTVFTYKDEQLFDFEVKTRKEIVRAS
ERLNNSFFSFRLFKDSVCNKRYWDRTEEGGFRLKKNVSAYDAVRDILRNSRLYGTECATA
IVIVFYLALTEVLPRELFDRLFPDIYLMDWKYLDKDLGVRNYRGVKDAIPGDCLYFKNPD
VNPDTPEWQGENVIKLLNGYYYGHGIGIKTADGIIRDLNRNRITGSERSAYLADLIVKPD
FKYLGEQLLFWHLRPQE

BLAST