GenomeNet

>csg:Cylst_1559 heme peroxidase family protein (A)
MAAQRDTSKDGLNNKIQTYVLTHFKGIWQFLQSNKSIARKVNKALINSLIYKIPTRPNPY
SMMTLDEYIPDTKIPKKTDTYTSWESLNDRTYTGRHLPPDPKLNAEGNLPKVEDLAILFR
KRDGKTIYSSKSTMLFPYWVQWFTDSFLRIDNYNKLKNTSNHEIELSNVYGLTRKQTHLL
RTFQGGKFKTQKLQRQDGVEEEYPLFYYADPAQGIVDPQFVGLYEPINDEKRQPTDKKQY
LFAMGVERANVQIGYVMLNTLCIREHNRLCDVLASNYPDWDDERLFQTSRNILMAMILKI
IMEEYINHITPYHFKLFADPEAFTKESWHRPNWMAIEFDFVYRWHSAIPETFKYNGQPTH
IADTLWNNKLFIDQGLGALMEETCSQAGTRIGLFNTPDILVELTELPSIKLGRQLQLASY
NDYRELCGFPRVTKFEQITSNEFAQKKLKELYGHVDNIEFYVGIYAEEVRQNSTIPPLVA
RIIGIDAFSEALTNSLLSPNIFNKDTFSPVGWEIIQNTKTVSDLVNRNVPPSGKKYKVTF
DL

BLAST