GenomeNet

>csg:Cylst_1559 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (GenBank) heme peroxidase family protein (A)
MAAQRDTSKDGLNNKIQTYVLTHFKGIWQFLQSNKSIARKVNKALINSLIYKIPTRPNPY
SMMTLDEYIPDTKIPKKTDTYTSWESLNDRTYTGRHLPPDPKLNAEGNLPKVEDLAILFR
KRDGKTIYSSKSTMLFPYWVQWFTDSFLRIDNYNKLKNTSNHEIELSNVYGLTRKQTHLL
RTFQGGKFKTQKLQRQDGVEEEYPLFYYADPAQGIVDPQFVGLYEPINDEKRQPTDKKQY
LFAMGVERANVQIGYVMLNTLCIREHNRLCDVLASNYPDWDDERLFQTSRNILMAMILKI
IMEEYINHITPYHFKLFADPEAFTKESWHRPNWMAIEFDFVYRWHSAIPETFKYNGQPTH
IADTLWNNKLFIDQGLGALMEETCSQAGTRIGLFNTPDILVELTELPSIKLGRQLQLASY
NDYRELCGFPRVTKFEQITSNEFAQKKLKELYGHVDNIEFYVGIYAEEVRQNSTIPPLVA
RIIGIDAFSEALTNSLLSPNIFNKDTFSPVGWEIIQNTKTVSDLVNRNVPPSGKKYKVTF
DL

BLAST