GenomeNet

>csg:Cylst_2043 ribulose bisphosphate carboxylase small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MQTLPKERRYETLSYLPPLSDAQIAKQIQYILNQGYIPAIEFNETSEPTELYWTMWKLPL
FGAKSTQEVLGEVQGCRSQFNNCYIRVVGFDNIKQCQVLSFLVHKPNKY

BLAST