GenomeNet

>csi:P262_02986 hypothetical protein; K05343 maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1] (A)
MSRLWHQNAVIYQIDPTRFFDSNADGWGDLRGIVEKLDYVESLGATAIWLTPFYLSPRRD
NGYDVENHTEPDPRIGSLEDVEWLIAEAEKRGIRVIIELVAQHTSDAHDWFQEARKGRDN
PFHDYYLWRDTPGPDEPAPMFPTIEPHIWRRDEQAQRYYRHLFYHHEPDLNLRHPDVILA
VDHVLRFWADKGVAGFRVDAASHMVEQATLPGDKESGYRLFNHFYDLLTEDHPDMILLGE
VDVNVSEFEDFFGGGERLTTLLNFWINKNTILALAREEAAPLVKALNELPMPPANGGYCF
WLRNHDELDLEDLEPEDYDFVMEKYAPDPDMRIYGRGIRRRLAPMLDGNERQQAMAHALL
FSLPGTPVVRYGAEIGMGDLLSQPERESVRTPMQWSAAPGAGFSACDPARFVEPLITDGP
FRYQAINVEEQEARDGSLLHRIRQIIAVWRTLPEICYQHFHPFTVREKSVFAVRYQNYNV
ATLMLTNLSHEAVTVDLGELDLQGACEILADDDYPPVACSLRINGYGYRWLRVK

BLAST