GenomeNet

>css:Cst_c16030 ligD1; DNA polymerase LigD; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MDPSEGQSFAQVTDAAMIIYNTLEELGIRSYCKTSGATGLQIAVPLAGEIDYDTARKVNE
FFGRYFAQKYPDVFTIERKINDRGKKIYFDYLQMWKGKTIICPYSPRATKTANVSAPVLW
EEVEKGIVPEDFTLKNIIQRLEEKGDLYESVYTSGLDAGIKNLMAEIM

BLAST