GenomeNet

>css:Cst_c16040 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD2; DNA polymerase LigD (A)
MNKSRLQISNPDKLLFPDVGITKLEYIEKLYELSGYILKYTKGRALTTIHYPDGVSEKSY
YQKNIPSHAPDFVSHKLIGDIDYIIMDSAETLLWLGNMAAL

BLAST