GenomeNet

>cst:CLOST_2219 tufB; protein chain elongation factor EF-Tu (duplicate of tufA); K02358 elongation factor Tu (A)
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKTLHARYGFGAAVDFENIDKAPEERER
GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREH
ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLNEYEFPGDDTPIIRGSALKAL
EDPASEWGDKIVELFEQIDSYIPEPERDIDKPFLMPVEDVFSITGRGTVATGRVERGILK
VQDEVEIVGLTEEARKVVVTGVEMFRKLLDQAQAGDNIGALLRGVTRDDIERGQVLAKSG
TIKPRTKFTAEIYVLKKEEGGRHTPFFKGYRPQFYFRTTDVTGDITLPDGVEMVMPGDNI
TISVELITPIAMEEGLRFAIREGGRTVGAGVVATIVE

BLAST