GenomeNet

>csv:101219491 probable hexokinase-like 2 protein-like; K00844 hexokinase [EC:2.7.1.1] (A)
MSIRKQFLLAALAASATLLLAAAALKRWKQRKQWQLKQAHRILRKFARDSATPVPKLWQI
AADLESDMRASIASVNGTTSNSSLKMLVSYTNAFPNGDEEGFYYGLNLRGTSFLILCARL
GGKNAPISDIHREEIPIPPNVMNGNSEDLFDFIAMEVGKFVSAHPENVYEPVKRTELGFT
LSYPVDDAAASLGNVIKWNSFSADDTVGKNMVNNINQALTNHGVNLLVSAMVDDTVGNLA
GGRYYCRDSVAAITLGMGTNAAYIESGQELAHLNGPSPTSREVGVSMQWGNFRSPHLPIT
EFDTSLDSESLNPGTQVFQKLVSGTYLGEIVRRILVKMAQETLLFGDPVPSKLMTPYVLR
SPDMAAMHQDTSEDREVVNEKLKEIFGVTDSTPMAREIVAEVCDVVSERAARLAGAGIVG
IVKKLGRIENKRNIVTVEGGLYEHYRVFRNYLNSSIWEMLGNELSDNVIVEHSHGGSGAG
AVFLASSQKENFDFELFNVG

BLAST