GenomeNet

>csv:101230278 thymidine kinase-like; K00857 thymidine kinase [EC:2.7.1.21] (A)
MESCRTSLPFTSSYADTVRPESSHRLAGEVHVIIGPMFAGKTTALLRRIKSESNSGRNVV
MIKSSKDTRYAIDSVVTHDGVKFPCWALPDLSSFRQKFGEDAYNELDVIGVDEAQFFDDL
YDFCCNVADRDGKIIVVAGLDGDYLRRSFGSVLDVVPLADTVTKLTARCELCGKRAFFTL
RKTEETKTELIAGADVYMPVCRHHYAIGQEVIQSSKNAMGSRTIASNLEALPSLI

BLAST