GenomeNet

>ctd:CTDEC_0322 K02358 elongation factor Tu | (GenBank) tuf; Protein Translation Elongation Factor Tu (EF-TU) (A)
MRIFEMSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGDGLADFRDYSSIDNTPE
EKARGITINASHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGAMPQ
TKEHILLARQVGVPYIVVFLNKIDMISEEDAELVDLVEMELVELLEEKGYKGCPIIRGSA
LKALEGDAAYIEKVRELMQAVDDNIPTPEREIDKPFLMPIEDVFSISGRGTVVTGRIERG
IVKVSDKVQLVGLRDTKETIVTGVEMFRKELPEGRAGENVGLLLRGIGKNDVERGMVVCL
PNSVKPHTQFKCAVYVLQKEEGGRHKPFFTGYRPQFFFRTTDVTGVVTLPEGIEMVMPGD
NVEFEVQLISPVALEEGMRFAIREGGRTIGAGTISKIIA

BLAST