GenomeNet

>cte:CT1772 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) rbcL; ribulose bisphosphate carboxylase, large subunit (A)
MNAEDVKGFFASRESLDMEQYLVLDYYLESVGDIETALAHFCSEQSTAQWKRVGVDEDFR
LVHAAKVIDYEVIEELEQLSYPVKHSETGKIHACRVTIAHPHCNFGPKIPNLLTAVCGEG
TYFTPGVPVVKLMDIHFPDTYLADFEGPKFGIEGLRDILNAHGRPIFFGVVKPNIGLSPG
EFAEIAYQSWLGGLDIAKDDEMLADVTWSSIEERAAHLGKARRKAEAETGEPKIYLANIT
DEVDSLMEKHDVAVRNGANALLINALPVGLSAVRMLSNYTQVPLIGHFPFIASFSRMEKY
GIHSKVMTKLQRLAGLDAVIMPGFGDRMMTPEEEVLENVIECTKPMGRIKPCLPVPGGSD
SALTLQTVYEKVGNVDFGFVPGRGVFGHPMGPKAGAKSIRQAWEAIEQGISIETWAETHP
ELQAMVDQSLLKKQD

BLAST