GenomeNet

>ctf:CTDLC_0322 tuf; Protein Translation Elongation Factor Tu (EF-TU); K02358 elongation factor Tu (A)
MRIFEMSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGDGLADFRDYSSIDNTPE
EKARGITINASHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGAMPQ
TKEHILLARQVGVPYIVVFLNKIDMISEEDAELVDLVEMELVELLEEKGYKGCPIIRGSA
LKALEGDAAYIEKVRELMQAVDDNIPTPEREIDKPFLMPIEDVFSISGRGTVVTGRIERG
IVKVSDKVQLVGLRDTKETIVTGVEMFRKELPEGRAGENVGLLLRGIGKNDVERGMVVCL
PNSVKPHTQFKCAVYVLQKEEGGRHKPFFTGYRPQFFFRTTDVTGVVTLPEGIEMVMPGD
NVEFEVQLISPVALEEGMRFAIREGGRTIGAGTISKIIA

BLAST