GenomeNet

>cti:RALTA_A1075 glutathione s-transferase enzyme with thioredoxin-like domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIDVYTWATPNGHKVHIMLEECGLEYKVHPINIGAGDQFGEDFLKISPNNKIPAIVDPHG
PDGKPISLFESGAILLYLAGKTGKFLPEDVRGKYETLQWLMFQMGGVGPMLGQAHHFRIY
APEQIAYAVNRYTNEAKRLYGVIDTQLSKHPWLAGDQYTIADIATFPWLRSWQNQGVELD
DYPHLKRWFNEIAERPAVKRGVEVLASARKALQDDKAREVLFGATQYKRH

BLAST