GenomeNet

>cti:RALTA_A1075 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) putative glutathione S-transferase enzyme with thioredoxin-like domain (A)
MIDVYTWATPNGHKVHIMLEECGLEYKVHPINIGAGDQFGEDFLKISPNNKIPAIVDPHG
PDGKPISLFESGAILLYLAGKTGKFLPEDVRGKYETLQWLMFQMGGVGPMLGQAHHFRIY
APEQIAYAVNRYTNEAKRLYGVIDTQLSKHPWLAGDQYTIADIATFPWLRSWQNQGVELD
DYPHLKRWFNEIAERPAVKRGVEVLASARKALQDDKAREVLFGATQYKRH

BLAST