GenomeNet

>cti:RALTA_A2415 hypothetical protein (A)
MTRILTLIAVAAGAAGAAFAPDALAKLPPPTEAQQAKAAETRARAAWSDKVAAYQLCRAQ
DKVATRYLADRKAHGQQVRDPVQTAACADPGPFVASAPAIASTAGAPAAGAVQSSAKAP

BLAST