GenomeNet

>cti:RALTA_A2415 no KO assigned | (GenBank) conserved hypothetical protein; putative exported protein (A)
MTRILTLIAVAAGAAGAAFAPDALAKLPPPTEAQQAKAAETRARAAWSDKVAAYQLCRAQ
DKVATRYLADRKAHGQQVRDPVQTAACADPGPFVASAPAIASTAGAPAAGAVQSSAKAP

BLAST