GenomeNet

>cti:RALTA_B1701 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; Ribulose bisphosphate carboxylase (RuBisCO), small subunit (A)
MRITQGTFSFLPELTDEQITKQLEYCLNKGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARNTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
LRYSIESYAVQARPEGSRY

BLAST