GenomeNet

>cti:RALTA_B1701 cbbS; ribulose bisphosphate carboxylase (rubisco), small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGTFSFLPELTDEQITKQLEYCLNKGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARNTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
LRYSIESYAVQARPEGSRY

BLAST