GenomeNet

>cti:RALTA_B1702 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL; Ribulose bisphosphate carboxylase (RuBisCO), large subunit (A)
MNAPEPVQGKPRKRYDAGVMKYKEMGYWDADYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMVDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTRTDL
TRGLFFDQDWASLRKVMPVASGGIHAGQMHQLISLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDITFNYTPTDTSDFV
PTASVA

BLAST